null

IGF-1 LR3 1mg Long R3 Receptor Grade (Not Part of BOGO Deal)

$69.99
Availability:
In Stock
Shipping:
Calculated at Checkout

Product Overview

 

CAS: 946870-92-4

Formula: C990H1528N262O300S7

Molecular weight: 9200

Peptide purity: > 98.0%

Appearance: White powder

Related substance: Total Impurities(%) ≤ 2.0%

Acetate content: ≤ 15.0%

Bacterial Endotoxins: ≤5 IU/mg

Chain:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA